PDB entry 1s40

View 1s40 on RCSB PDB site
Description: solution structure of the cdc13 DNA-binding domain complexed with a single-stranded telomeric DNA 11-mer
Class: cell cycle/DNA
Keywords: ssDNA, single-stranded nucleic acid, recognition, specificity, cdc13, OB-fold, telomere, NMR
Deposited on 2004-01-14, released 2004-05-04
The last revision prior to the SCOP 1.73 freeze date was dated 2004-05-04, with a file datestamp of 2007-06-04.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division control protein 13
    Species: Saccharomyces cerevisiae
    Gene: CDC13, YDL220C
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s40a_
  • Chain 'B':
    Compound: 5'-d(*gp*tp*gp*tp*gp*gp*gp*tp*gp*tp*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s40A (A:)
    mrmskmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqn
    ylydrylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygi
    vckmnikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisr
    yfeeyrrffpihrngshla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s40A (A:)
    kmarkdptiefcqlgldtfetkyitmfgmlvscsfdkpafisfvfsdftkndivqnylyd
    rylidyenklelnegfkaimyknqfetfdsklrkifnnglrdlqngrdenlsqygivckm
    nikvkmyngklnaivrecepvphsqissiaspsqcehlrlfyqrafkrigesaisryfee
    yrrffpi
    

  • Chain 'B':
    No sequence available.