PDB entry 1s3z

View 1s3z on RCSB PDB site
Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin
Deposited on 2004-01-14, released 2004-05-18
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-18, with a file datestamp of 2004-05-18.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s3za_
  • Chain 'B':
    Domains in SCOP 1.71: d1s3zb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3zA (A:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3zA (A:)
    shmdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfa
    dasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtsp
    entisqkvhqalgfeetervifyrkrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3zB (B:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3zB (B:)
    mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
    sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
    tisqkvhqalgfeetervifyrkrc