PDB entry 1s3z

View 1s3z on RCSB PDB site
Description: Aminoglycoside N-Acetyltransferase AAC(6')-Iy in Complex with CoA and Ribostamycin
Class: transferase
Keywords: GNAT, N-acetyltransferase, acetyltransferase, aminoglycoside, CoA, ribostamycin, transferase
Deposited on 2004-01-14, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.167
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Salmonella enteritidis [TaxId:592]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9R381 (20-164)
      • expression tag (18-19)
    Domains in SCOPe 2.08: d1s3za1, d1s3za2
  • Chain 'B':
    Compound: aminoglycoside 6'-N-acetyltransferase
    Species: Salmonella enteritidis [TaxId:592]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s3zb_
  • Heterogens: NI, SO4, COA, RIO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3zA (A:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3zA (A:)
    shmdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfa
    dasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtsp
    entisqkvhqalgfeetervifyrkrc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3zB (B:)
    mgsshhhhhhssglvprgshmdirqmnkthlehwrglrkqlwpghpddahladgeeilqa
    dhlasfiamadgvaigfadasirhdyvngcdsspvvflegifvlpsfrqrgvakqliaav
    qrwgtnkgcremasdtspentisqkvhqalgfeetervifyrkrc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3zB (B:)
    mdirqmnkthlehwrglrkqlwpghpddahladgeeilqadhlasfiamadgvaigfada
    sirhdyvngcdsspvvflegifvlpsfrqrgvakqliaavqrwgtnkgcremasdtspen
    tisqkvhqalgfeetervifyrkrc