PDB entry 1s3s

View 1s3s on RCSB PDB site
Description: Crystal structure of AAA ATPase p97/VCP ND1 in complex with p47 C
Class: protein binding
Keywords: AAA ATPase, p97, p47, protein-protein complex, UBX domain, PROTEIN BINDING
Deposited on 2004-01-14, released 2004-03-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.248
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sa1, d1s3sa2, d1s3sa3
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sb1, d1s3sb2, d1s3sb3
  • Chain 'C':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sc1, d1s3sc2, d1s3sc3
  • Chain 'D':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sd1, d1s3sd2, d1s3sd3
  • Chain 'E':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3se1, d1s3se2, d1s3se3
  • Chain 'F':
    Compound: Transitional endoplasmic reticulum ATPase (TER ATPase) (15S Mg(2+)- ATPase p97 subunit) (Valosin containing protein) (VCP) [Contains: Valosin]
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sf1, d1s3sf2, d1s3sf3
  • Chain 'G':
    Compound: p47 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sg_
  • Chain 'H':
    Compound: p47 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3sh_
  • Chain 'I':
    Compound: p47 protein
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s3si_
  • Heterogens: ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3sA (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sA (A:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevg
    yddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanet
    gaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgever
    rivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilq
    ihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevm
    nslavtmddfrwalsq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3sB (B:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sB (B:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevg
    yddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanet
    gaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgever
    rivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilq
    ihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevm
    nslavtmddfrwalsq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s3sC (C:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sC (C:)
    rpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdek
    irmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfle
    ayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnev
    gyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravane
    tgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgeve
    rrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleil
    qihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaev
    mnslavtmddfrwalsq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s3sD (D:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sD (D:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevg
    yddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanet
    gaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgever
    rivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilq
    ihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevm
    nslavtmddfrwalsq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s3sE (E:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sE (E:)
    pnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsdeki
    rmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyflea
    yrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslnevg
    yddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravanet
    gaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgever
    rivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrleilq
    ihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidaevm
    nslavtmddfrwalsq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s3sF (F:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sF (F:)
    kqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtc
    sdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkp
    yfleayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeees
    lnevgyddvggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliara
    vanetgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekth
    geverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgr
    leilqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledeti
    daevmnslavtmddfrwalsq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s3sG (G:)
    vkpkgafkaftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirla
    dggrlvqkfnhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllna
    vivqrlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sG (G:)
    ftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirladggrlvqkf
    nhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s3sH (H:)
    vkpkgafkaftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirla
    dggrlvqkfnhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllna
    vivqrlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sH (H:)
    gqklgstappaqqaeneakasssilineaepttniqirladggrlvqkfnhshrisdirl
    fivdarpamaatsfvlmttfpnkeladenqtlkeanllnavivqrlt
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s3sI (I:)
    vkpkgafkaftgegqklgstapqvlntsspaqqaeneakasssilineaepttniqirla
    dggrlvqkfnhshrisdirlfivdarpamaatsfvlmttfpnkeladenqtlkeanllna
    vivqrlt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3sI (I:)
    aeneakasssihshrisdirlfiv