PDB entry 1s3q

View 1s3q on RCSB PDB site
Description: Crystal structures of a novel open pore ferritin from the hyperthermophilic Archaeon Archaeoglobus fulgidus
Class: metal binding protein
Keywords: Ferroxidase, four helix bundle, iron storage, METAL BINDING PROTEIN
Deposited on 2004-01-13, released 2005-04-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.181
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qa1
  • Chain 'B':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qb_
  • Chain 'C':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qc_
  • Chain 'D':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qd_
  • Chain 'E':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qe_
  • Chain 'F':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qf_
  • Chain 'G':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qg_
  • Chain 'H':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qh_
  • Chain 'I':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qi_
  • Chain 'J':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424 (0-End)
      • modified residue (0)
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qj_
  • Chain 'K':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3qk_
  • Chain 'L':
    Compound: Ferritin
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: Ftn
    Database cross-references and differences (RAF-indexed):
    • Uniprot O29424
      • modified residue (7)
      • modified residue (28)
      • modified residue (44)
      • modified residue (53)
      • modified residue (56)
      • modified residue (58)
      • modified residue (108)
      • modified residue (110)
    Domains in SCOPe 2.06: d1s3ql_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3qA (A:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qA (A:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3qB (B:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qB (B:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s3qC (C:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qC (C:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s3qD (D:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qD (D:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s3qE (E:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qE (E:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s3qF (F:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qF (F:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s3qG (G:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qG (G:)
    asisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfd
    fvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynf
    lqwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s3qH (H:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qH (H:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s3qI (I:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qI (I:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s3qJ (J:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qJ (J:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s3qK (K:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qK (K:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s3qL (L:)
    masisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmf
    dfvserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatyn
    flqwyvaeqveeeasaldiveklrligedkrallfldkelslrqftppaeeek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3qL (L:)
    sisekmvealnrqinaeiysaylylsmasyfdsiglkgfsnwmrvqwqeelmhamkmfdf
    vserggrvklyaveeppsewdsplaafehvyehevnvtkrihelvemamqekdfatynfl
    qwyvaeqveeeasaldiveklrligedkrallfldkelslrq