PDB entry 1s3k

View 1s3k on RCSB PDB site
Description: Crystal Structure of a Humanized Fab (hu3S193) in Complex with the Lewis Y Tetrasaccharide
Class: immune system
Keywords: Immunoglobulin fold, Beta Barrel, Humanized antibody, Antigen binding fragment
Deposited on 2004-01-13, released 2004-07-13
The last revision prior to the SCOP 1.75 freeze date was dated 2004-07-13, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: -1.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: HU3S193 Fab fragment, heavy chain
    Species: MUS MUSCULUS AND HOMO SAPIENS
    Domains in SCOP 1.75: d1s3kh1, d1s3kh2
  • Chain 'L':
    Compound: HU3S193 Fab fragment, light chain
    Species: MUS MUSCULUS AND HOMO SAPIENS
    Domains in SCOP 1.75: d1s3kl1, d1s3kl2
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s3kH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3kH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapgtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s3kL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3kL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr