PDB entry 1s3k

View 1s3k on RCSB PDB site
Description: Crystal Structure of a Humanized Fab (hu3S193) in Complex with the Lewis Y Tetrasaccharide
Deposited on 2004-01-13, released 2004-07-13
The last revision prior to the SCOP 1.71 freeze date was dated 2004-07-13, with a file datestamp of 2004-07-13.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: -1.54 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s3kH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapsskstsggtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssg
    lyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3kH (H:)
    evqlvesgggvvqpgrslrlscstsgftfsdyymywvrqapgkglewvaymsnvgaitdy
    pdtvkgrftisrdnskntlflqmdslrpedtgvyfcargtrdgswfaywgqgtpvtvssa
    stkgpsvfplapgtaalgclvkdyfpqpvtvswnsgaltsgvhtfpavlqssglyslssv
    vtvpssslgtqtyicnvnhkpsntkvdkkvep
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s3kL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3kL (L:)
    diqmtqspsslsasvgdrvtitcrssqrivhsngntylewyqqtpgkapklliykvsnrf
    sgvpsrfsgsgsgtdftftisslqpediatyycfqgshvpftfgqgtklqitrtvaapsv
    fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
    sstltlskadyekhkvyacevthqglsspvtksfnr