PDB entry 1s3j

View 1s3j on RCSB PDB site
Description: X-ray crystal structure of YusO protein from Bacillus subtilis
Deposited on 2004-01-13, released 2004-04-13
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-13, with a file datestamp of 2004-04-13.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s3ja_
  • Chain 'B':
    Domains in SCOP 1.67: d1s3jb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3jA (A:)
    mksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaer
    mevkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryl
    sflteeemlqaahitaklaqaaetdekqnmkrgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3jA (A:)
    sadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerme
    vkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimarylsf
    lteeemlqaahitaklaqaaetd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s3jB (B:)
    mksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaer
    mevkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryl
    sflteeemlqaahitaklaqaaetdekqnmkrgng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3jB (B:)
    ksadqlmsdiqlslqalfqkiqpemlesmekqgvtpaqlfvlaslkkhgslkvseiaerm
    evkpsavtlmadrleqknliarthntkdrrvidlsltdegdikfeevlagrkaimaryls
    flteeemlqaahitaklaqaa