PDB entry 1s3h

View 1s3h on RCSB PDB site
Description: propionibacterium shermanii transcarboxylase 5s subunit a59t
Deposited on 2004-01-13, released 2004-09-07
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-28, with a file datestamp of 2004-09-28.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s3hA (A:)
    maisrelvdpnsspreievseprevgitelvlrdahqslmatrmamedmvgacadidaag
    ywsvecwggttydscirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvd
    rfvdksaengmdvfrvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvkl
    agqlldmgadsialkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmk
    aieagvdvvdtaissmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpky
    kkfesktlvdtsifksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvt
    pssqivgtqavfnvmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitq
    rpadllppewekqskeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaq
    lkaeaegdekslavagpvtynvnvggtvrevtvqqatrasqpelapedpedlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s3hA (A:)
    preievseprevgitelvlrdahqslmatrmamedmvgacadidaagywsvecwggttyd
    scirflnedpwerlrtfrklmpnsrlqmllrgqnllgyrhyndevvdrfvdksaengmdv
    frvfdamndprnmahamaavkkagkhaqgticytispvhtvegyvklagqlldmgadsia
    lkdmaallkpqpaydiikaikdtygqktqinlhchsttgvtevslmkaieagvdvvdtai
    ssmslgpghnptesvaemlegtgyttnldydrlhkirdhfkairpkykkfesktlvdtsi
    fksqipggmlsnmesqlraqgaedkmdevmaevprvrkaagfpplvtpssqivgtqavfn
    vmmgeykrmtgefadimlgyygaspadrdpkvvklaeeqsgkkpitqrpadllppewekq
    skeaatlkgfngtdedvltyalfpqvapvffehraegphsvaltdaqlkaea