PDB entry 1s3g

View 1s3g on RCSB PDB site
Description: Crystal structure of adenylate kinase from Bacillus globisporus
Deposited on 2004-01-13, released 2004-05-04
The last revision prior to the SCOP 1.67 freeze date was dated 2004-05-04, with a file datestamp of 2004-05-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.223
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s3gA (A:)
    mnivlmglpgagkgtqadrivekygtphistgdmfraaiqegtelgvkaksfmdqgalvp
    devtigivrerlsksdcdngflldgfprtvpqaealdqlladmgrkiehvlniqvekeel
    iarltgrrickvcgtsyhllfnppqvegkcdkdggelyqraddnpdtvtnrlevnmnqta
    pllafydskevlvningqkdikdvfkdldvilqgngq