PDB entry 1s36

View 1s36 on RCSB PDB site
Description: Crystal structure of a Ca2+-discharged photoprotein: Implications for the mechanisms of the calcium trigger and the bioluminescence
Class: luminescent protein
Keywords: Photoprotein, obelin, bioluminescence, calcium binding, EF-hand, aequorin, Structural Genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, LUMINESCENT PROTEIN
Deposited on 2004-01-12, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: obelin
    Species: Obelia longissima [TaxId:32570]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q27709 (Start-194)
      • engineered (91)
    Domains in SCOPe 2.08: d1s36a_
  • Heterogens: NA, CL, CEI, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s36A (A:)
    msskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeq
    tkrhqvcveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfd
    ifdkdgsgtitldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwy
    tldpeadglygngvp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s36A (A:)
    vklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqv
    cveaffrgcgmeygkeiafpqfldgfkqlatselkkwarneptlirewgdavfdifdgti
    tldewkaygkisgispsqedceatfrhcdldnsgdldvdemtrqhlgfwytldpeadgly
    gngvp