PDB entry 1s32

View 1s32 on RCSB PDB site
Description: Molecular Recognition of the Nucleosomal 'Supergroove'
Class: structural protein/DNA
Keywords: Nucleosome Core Particle (NCP), Pyrrole-Imidazole (Py-Im) hairpin polyamide, clamp, nucleosome dynamics, STRUCTURAL PROTEIN-DNA COMPLEX
Deposited on 2004-01-12, released 2004-05-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.219
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • GB CAD89679
    Domains in SCOPe 2.06: d1s32a_
  • Chain 'B':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s32b_
  • Chain 'C':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • GB CAD89676
    Domains in SCOPe 2.06: d1s32c_
  • Chain 'D':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone H2B.1
    Database cross-references and differences (RAF-indexed):
    • GB CAD89678
    Domains in SCOPe 2.06: d1s32d_
  • Chain 'E':
    Compound: histone h3
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H3
    Database cross-references and differences (RAF-indexed):
    • GB CAD89679 (Start-134)
    Domains in SCOPe 2.06: d1s32e_
  • Chain 'F':
    Compound: histone h4
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1s32f_
  • Chain 'G':
    Compound: histone h2a
    Species: Xenopus laevis [TaxId:8355]
    Gene: HISTONE H2A
    Database cross-references and differences (RAF-indexed):
    • GB CAD89676 (Start-117)
    Domains in SCOPe 2.06: d1s32g_
  • Chain 'H':
    Compound: histone h2b
    Species: Xenopus laevis [TaxId:8355]
    Gene: Histone H2B.1
    Database cross-references and differences (RAF-indexed):
    • GB CAD89678 (Start-121)
    Domains in SCOPe 2.06: d1s32h_
  • Chain 'I':
    Compound: palindromic alpha-satellite 146 bp DNA fragment
  • Chain 'J':
    Compound: palindromic alpha-satellite 146 bp DNA fragment
  • Heterogens: MN, CL, IMT, OGG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s32A (A:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32A (A:)
    phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
    aylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s32B (B:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32B (B:)
    lrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktv
    tamdvvyalkrqgrtlygfgg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s32C (C:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32C (C:)
    akaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaar
    dnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s32D (D:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32D (D:)
    dgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahyn
    krstitsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s32E (E:)
    artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
    lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
    pkdiqlarrirgera
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32E (E:)
    kphryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqeas
    eaylvalfedtnlcaihakrvtimpkdiqlarrirgera
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s32F (F:)
    sgrgkggkglgkggakrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkv
    flenvirdavtytehakrktvtamdvvyalkrqgrtlygfgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32F (F:)
    akrhrkvlrdniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtyte
    hakrktvtamdvvyalkrqgrtlygfgg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s32G (G:)
    sgrgkqggktrakaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleylta
    eilelagnaardnkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32G (G:)
    kaktrssraglqfpvgrvhrllrkgnyaervgagapvylaavleyltaeilelagnaard
    nkktriiprhlqlavrndeelnkllgrvtiaqggvlpniqsvllpkk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s32H (H:)
    aksapapkkgskkavtktqkkdgkkrrktrkesyaiyvykvlkqvhpdtgisskamsimn
    sfvndvferiageasrlahynkrstitsreiqtavrlllpgelakhavsegtkavtkyts
    ak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s32H (H:)
    krrktrkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrs
    titsreiqtavrlllpgelakhavsegtkavtkytsak
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.