PDB entry 1s2x

View 1s2x on RCSB PDB site
Description: Crystal structure of Cag-Z from Helicobacter pylori
Class: unknown function
Keywords: Cag-Z, Helicobacter pylori, cag pathogenicity island, type IV secretion system, UNKNOWN FUNCTION
Deposited on 2004-01-12, released 2004-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.245
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cag-Z
    Species: Helicobacter pylori [TaxId:210]
    Gene: cagZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JMX9 (7-End)
      • cloning artifact (6)
      • engineered (7)
      • modified residue (27)
      • modified residue (65)
      • modified residue (150-151)
    Domains in SCOPe 2.07: d1s2xa1, d1s2xa2
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2xA (A:)
    gspnsrvdelgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvq
    elrinmqknfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfn
    nftcdevarisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyi
    ilsknktyltsleraklitqlklnle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2xA (A:)
    vdelgfneaerqkildsnsslmrnanevrdkfiqnyatslkdsndpqdflrrvqelrinm
    qknfisfdayynylnnlvlasynrckqektfaestikneltlgefvaeisdnfnnftcde
    varisdlvasylpreylppfidgnmmgvafqilgiddfgkklneivqdigtkyiilsknk