PDB entry 1s2w

View 1s2w on RCSB PDB site
Description: Crystal structure of phosphoenolpyruvate mutase in high ionic strength
Class: isomerase
Keywords: phosphonopyruvate, phosphonate biosynthesis pathway, ISOMERASE
Deposited on 2004-01-11, released 2004-05-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.69 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d1s2wa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2wA (A:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2wA (A:)
    kvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlwtqvvevle
    fmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfgraqpladieefal
    kikackdsqtdpdfcivarveafiagwgldealkraeayrnagadailmhskkadpsdie
    afmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlrasvsaiqqttkqiyddq
    slvnvedkivsvkeifrl