PDB entry 1s2v

View 1s2v on RCSB PDB site
Description: Crystal structure of phosphoenolpyruvate mutase complexed with Mg(II)
Class: isomerase
Keywords: phosphoenolpyruvate mutase, PEP mutase, phosphonopyruvate, phosphonate biosynthesis pathway, x-ray structure, ISOMERASE
Deposited on 2004-01-11, released 2004-05-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.185
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d1s2va_
  • Chain 'B':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d1s2vb_
  • Chain 'C':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d1s2vc_
  • Chain 'D':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.03: d1s2vd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2vA (A:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2vA (A:)
    vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneasw
    tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnqp
    ladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnagadailmhs
    kkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlrasvsaiqq
    ttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s2vB (B:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2vB (B:)
    kvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneas
    wtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktns
    graqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnagada
    ilmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlrasv
    saiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s2vC (C:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2vC (C:)
    kvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneas
    wtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpkqpl
    adieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnagadailmhsk
    kadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlrasvsaiqqt
    tkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s2vD (D:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2vD (D:)
    kvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrdsneas
    wtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpqpla
    dieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnagadailmhskk
    adpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlrasvsaiqqtt
    kqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpk