PDB entry 1s2u

View 1s2u on RCSB PDB site
Description: Crystal structure of the D58A phosphoenolpyruvate mutase mutant protein
Class: isomerase
Keywords: phosphoenolpyruvate mutase, PEP mutase, phosphonopyruvate, phosphonate biosynthesis pathway, ISOMERASE
Deposited on 2004-01-11, released 2004-05-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.165
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • engineered (57)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.07: d1s2ua_
  • Chain 'B':
    Compound: Phosphoenolpyruvate phosphomutase
    Species: Mytilus edulis [TaxId:6550]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56839
      • see remark 999 (13)
      • see remark 999 (23)
      • engineered (57)
      • see remark 999 (73)
      • see remark 999 (188)
      • see remark 999 (202)
      • see remark 999 (229)
      • see remark 999 (233)
    Domains in SCOPe 2.07: d1s2ub_
  • Heterogens: PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2uA (A:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrasn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2uA (A:)
    vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrasneasw
    tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
    hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
    dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
    svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s2uB (B:)
    mstkvkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrasn
    easwtqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpk
    tnslhdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayr
    nagadailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanh
    nlrasvsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylpkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2uB (B:)
    vkkttqlkqmlnskdlefimeahnglsarivqeagfkgiwgsglsvsaqlgvrasneasw
    tqvvevlefmsdasdvpilldadtgygnfnnarrlvrkledrgvagacledklfpktnsl
    hdgraqpladieefalkikackdsqtdpdfcivarveafiagwgldealkraeayrnaga
    dailmhskkadpsdieafmkawnnqgpvvivptkyyktptdhfrdmgvsmviwanhnlra
    svsaiqqttkqiyddqslvnvedkivsvkeifrlqrddelvqaedkylp