PDB entry 1s2o

View 1s2o on RCSB PDB site
Description: X-Ray structure of the sucrose-phosphatase (SPP) from Synechocystis sp. PCC6803 at 1.40 A resolution
Class: hydrolase
Keywords: phosphohydrolase, HAD superfamily, sucrose, cyanobacteria, HYDROLASE
Deposited on 2004-01-09, released 2005-02-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.182
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sucrose-Phosphatase
    Species: Synechocystis sp. [TaxId:1148]
    Gene: spp
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s2oa1
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1s2oA (A:)
mrqlllisdldntwvgdqqalehlqeylgdrrgnfylayatgrsyhsarelqkqvglmep
dywltavgseiyhpegldqhwadylsehwqrdilqaiadgfealkpqspleqnpwkisyh
ldpqacptvidqltemlketgipvqvifssgkdvdllpqrsnkgnatqylqqhlamepsq
tlvcgdsgndiglfetsargvivrnaqpellhwydqwgdsrhyraqsshagaileaiahf
dfls