PDB entry 1s2k

View 1s2k on RCSB PDB site
Description: Structure of SCP-B a member of the Eqolisin family of Peptidases in a complex with a Tripeptide Ala-Ile-His
Class: hydrolase
Keywords: Beta Sandwich, Pepstatin insensitive carboxyl peptidase, protease, proteinase, Eqolisin family, complex with Ala-Ile-His, hydrolase
Deposited on 2004-01-08, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scytalidopepsin B
    Species: Scytalidium lignicola [TaxId:5539]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s2ka_
  • Chain 'B':
    Compound: Ala-Ile-His tripeptide
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1S2K (0-2)
  • Heterogens: TYR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2kA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
    essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
    itqviinnqdvtdcsvsgttvscsyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2kA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewevsitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnessgslc
    rtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqitqviin
    nqdvtdcsvsgttvscsyv
    

  • Chain 'B':
    No sequence available.