PDB entry 1s2j

View 1s2j on RCSB PDB site
Description: Crystal structure of the Drosophila pattern-recognition receptor PGRP-SA
Class: hydrolase
Keywords: mixed beta-sheet, pi-helix (one turn), HYDROLASE
Deposited on 2004-01-08, released 2004-09-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.196
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidoglycan recognition protein SA CG11709-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PGRP-SA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VYX7 (Start-202)
      • expression tag (203-204)
    Domains in SCOPe 2.06: d1s2ja1, d1s2ja2
  • Chain 'B':
    Compound: Peptidoglycan recognition protein SA CG11709-PA
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: PGRP-SA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9VYX7 (Start-202)
      • expression tag (203)
    Domains in SCOPe 2.06: d1s2jb1, d1s2jb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2jA (A:)
    mqpvrfgspwimaiglvllllafvsagksrqrspancptiklkrqwggkpslglhyqvrp
    iryvvihhtvtgecsgllkcaeilqnmqayhqneldfndisynfligndgivyegtgwgl
    rgahtygynaigtgiafignfvdklpsdaalqaakdllacgvqqgelsedyaliagsqvi
    stqspgltlyneiqewphwlsnphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2jA (A:)
    cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
    fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
    llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnphh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s2jB (B:)
    mqpvrfgspwimaiglvllllafvsagksrqrspancptiklkrqwggkpslglhyqvrp
    iryvvihhtvtgecsgllkcaeilqnmqayhqneldfndisynfligndgivyegtgwgl
    rgahtygynaigtgiafignfvdklpsdaalqaakdllacgvqqgelsedyaliagsqvi
    stqspgltlyneiqewphwlsnphhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2jB (B:)
    cptiklkrqwggkpslglhyqvrpiryvvihhtvtgecsgllkcaeilqnmqayhqneld
    fndisynfligndgivyegtgwglrgahtygynaigtgiafignfvdklpsdaalqaakd
    llacgvqqgelsedyaliagsqvistqspgltlyneiqewphwlsnph