PDB entry 1s2b

View 1s2b on RCSB PDB site
Description: Structure of SCP-B the first member of the Eqolisin family of Peptidases to have its structure determined
Class: hydrolase
Keywords: BETA SANDWICH, carboxyl peptidase, protease, proteinase, Eqolisin family
Deposited on 2004-01-08, released 2004-04-27
The last revision prior to the SCOP 1.73 freeze date was dated 2004-04-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.23
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Scytalidopepsin B
    Species: Scytalidium lignicolum
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1s2ba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s2bA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewypevsddfsgitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsn
    essgslcrtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaq
    itqviinnqdvtdcsvsgttvscsyv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s2bA (A:)
    tvesnwggailigsdfdtvsatanvpsasggssaagtawvgidgdtcqtailqtgfdwyg
    dgtydawyewevsitisegdsiqmsvtatsdtsgsatlenlttgqkvsksfsnessgslc
    rtnaefiiedfeecnsngsdcefvpfasfspaveftdcsvtsdgesvslddaqitqviin
    nqdvtdcsvsgttvscsyv