PDB entry 1s29

View 1s29 on RCSB PDB site
Description: La autoantigen N-terminal domain
Class: RNA binding protein
Keywords: winged helix-turn-helix, autoantigen, RNA-binding, RNA BINDING PROTEIN
Deposited on 2004-01-08, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.232
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: La protein
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NIH4 (3-91)
      • cloning artifact (0-2)
      • modified residue (3)
      • modified residue (36)
      • modified residue (83)
    Domains in SCOPe 2.08: d1s29a1, d1s29a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s29A (A:)
    gshmplssenkqklqkqvefyfsdvnvqrdiflkgkmaenaegfvsletlltfkrvnsvt
    tdvkevveairpseklvlsedglmvrrrdplp