PDB entry 1s21

View 1s21 on RCSB PDB site
Description: Crystal Structure of AvrPphF ORF2, A Type III Effector from P. syringae
Class: chaperone
Keywords: predominantly beta-strand, chaperone
Deposited on 2004-01-07, released 2004-09-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf2
    Species: Pseudomonas savastanoi [TaxId:319]
    Gene: AvrPphF ORF2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s21a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s21A (A:)
    gamgnicnsggvsrtyspptspvygsgvsspsrfvgqytltsihqlsseerenfldahdp
    mrvydlnsetsvyrttqreyvrngyatgnpnsgaiialheelqespyaqhigarpdqada
    yrprtahvsslntpslnvmagqgalsalrgyagsdhvttemrlgdfldqggkvysdtsam
    saggdsvealivtlpkgrkvpvnild
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s21A (A:)
    psrfvgqytltsihqlsseerenfldahdpmrvydlnsetsvyrttqreyvrngyatgnp
    nsgaiialheelqespyaqhigarpdqadayrprtahvsslntpslnvmagqgalsalhv
    ttemrlgdfldqggkvysdtsggdsvealivtlpkgrkvpvnild