PDB entry 1s20

View 1s20 on RCSB PDB site
Description: A novel NAD binding protein revealed by the crystal structure of E. Coli 2,3-diketogulonate reductase (YiaK) NORTHEAST STRUCTURAL GENOMICS CONSORTIUM TARGET ER82
Class: oxidoreductase
Keywords: alpha beta dimeric protein, OXIDOREDUCTASE, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2004-01-07, released 2004-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-04-14, with a file datestamp of 2010-04-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.191
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20a1, d1s20a2
  • Chain 'B':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20b1, d1s20b2
  • Chain 'C':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20c1, d1s20c2
  • Chain 'D':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20d1, d1s20d2
  • Chain 'E':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20e1, d1s20e2
  • Chain 'F':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332)
    Domains in SCOPe 2.07: d1s20f1, d1s20f2
  • Chain 'G':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
      • expression tag (334)
    Domains in SCOPe 2.07: d1s20g1, d1s20g2
  • Chain 'H':
    Compound: Hypothetical oxidoreductase yiaK
    Species: Escherichia coli [TaxId:562]
    Gene: YIAK, B3575
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37672 (0-331)
      • modified residue (0)
      • modified residue (31)
      • modified residue (92-93)
      • modified residue (117)
      • modified residue (143)
      • modified residue (169)
      • modified residue (172)
      • modified residue (174)
      • modified residue (176)
      • modified residue (181)
      • modified residue (220)
      • modified residue (228)
      • modified residue (234)
      • modified residue (284)
      • cloning artifact (332-333)
    Domains in SCOPe 2.07: d1s20h1, d1s20h2
  • Heterogens: TLA, NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s20A (A:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20A (A:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s20B (B:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20B (B:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s20C (C:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20C (C:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s20D (D:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20D (D:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1s20E (E:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20E (E:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s20F (F:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20F (F:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqall
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1s20G (G:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20G (G:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalleh
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s20H (H:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqallehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s20H (H:)
    mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
    iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
    gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
    gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
    sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
    rlpghefttllaenrrngitvddsvwakiqalle