PDB entry 1s1z

View 1s1z on RCSB PDB site
Description: Photoactivated chromophore conformation in Photoactive Yellow Protein (E46Q mutant) from 10 to 500 nanoseconds
Class: photoreceptor
Keywords: room temperature, time-resolved
Deposited on 2004-01-07, released 2004-06-15
The last revision prior to the SCOP 1.75 freeze date was dated 2004-08-17, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.053
AEROSPACI score: 0.8 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Photoactive yellow protein
  Species: Ectothiorhodospira halophila
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16113 (0-124)
    • engineered (45)
  Domains in SCOP 1.75: d1s1za_
• Heterogens: HC4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s1zA (A:)
  mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
  nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
  fvkrv