PDB entry 1s1z

View 1s1z on RCSB PDB site
Description: Photoactivated chromophore conformation in Photoactive Yellow Protein (E46Q mutant) from 10 to 500 nanoseconds
Class: photoreceptor
Keywords: room temperature, time-resolved, PHOTORECEPTOR
Deposited on 2004-01-07, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Photoactive yellow protein
    Species: HALORHODOSPIRA HALOPHILA [TaxId:1053]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P16113 (0-124)
      • engineered (45)
    Domains in SCOPe 2.08: d1s1za_
  • Heterogens: HC4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1zA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv