PDB entry 1s1y

View 1s1y on RCSB PDB site
Description: photoactivated chromophore conformation in photoactive yellow protein (e46q mutant) from 10 microseconds to 3 milliseconds
Deposited on 2004-01-07, released 2004-06-15
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.07
AEROSPACI score: 0.68 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1s1ya_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1yA (A:)
    mehvafgsedientlakmddgqldglafgaiqldgdgnilqynaaqgditgrdpkqvigk
    nffkdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywv
    fvkrv