PDB entry 1s1x

View 1s1x on RCSB PDB site
Description: Crystal structure of V108I mutant HIV-1 reverse transcriptase in complex with nevirapine
Deposited on 2004-01-07, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.235
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1xA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtildvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1xA (A:)
    ispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvf
    aikkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtildvgdayfsvpldedfrk
    ytaftipsinnetiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddly
    vgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqpivlpe
    kdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelaenre
    ilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkql
    teavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyq
    lekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqd
    sglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqv
    dklvsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1xB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtildvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1xB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikk
    kdstkwrklvdfrelnkrtqdfwhpaglkkkksvtildvgdayfsvpldedfrkytafti
    psinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsd
    leigqhrtkieelrqhllrwgltelhpdkwtvqpivlpekdswtvndiqklvgklnwasq
    iypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaei
    qkqgqgqwtyqiyqepfknlktgkyarmrgtndvkqlteavqkittesiviwgktpkfkl
    piqketwetwwteywqatwipewefvntpplvklwyq