PDB entry 1s1v

View 1s1v on RCSB PDB site
Description:
Deposited on 2004-01-07, released 2004-06-29
The last revision prior to the SCOP 1.71 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.233
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1s1va1, d1s1va2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d1s1vb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1vA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1vA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faiktkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpldedf
    rkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqym
    ddlyvgsdleigqhrtkieelrqhllrwglttpkkhqkeppflwmgyelhpdkwtvqpiv
    lpekdswtvndiqklvgklnwasqiypgikvrqlakllrgtkalteviplteeaelelae
    nreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndv
    kqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvkl
    wyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiyla
    lqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpah
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1vB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1vB (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaiks
    tkwrklvdfrelnkrtqdfwgiphpagikkkksvtvldvgdayfsvpldedfrkytafti
    psinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyvgsd
    leigqhrtkieelrqhllrwelhpdkwtvqpivlpekdswtvndiqklvgklnwasqiyp
    gikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskdliaeiqkq
    gqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwgktpkfklp
    iqketwetwwteywqatwipewefvntpplvklwyqlekepivg