PDB entry 1s1t

View 1s1t on RCSB PDB site
Description: Crystal structure of L100I mutant HIV-1 reverse transcriptase in complex with UC-781
Class: transferase
Keywords: hiv-1 reverse transcriptase, aids, nnrti, uc-781, drug resistance mutations, transferase
Deposited on 2004-01-07, released 2004-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585
      • engineered (99)
      • modified residue (279)
    Domains in SCOPe 2.08: d1s1ta1, d1s1ta2
  • Chain 'B':
    Compound: reverse transcriptase
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04585 (Start-439)
      • engineered (99)
    Domains in SCOPe 2.08: d1s1tb_
  • Heterogens: PO4, UC1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1tA (A:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelq
    aiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahk
    giggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1tA (A:)
    spietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfa
    ikwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpldedfrkyt
    aftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddly
    vgsdleigqhrtkieelrqhllrwglttpkkhqkeppflwmgyelhpdkwtvqpivlpek
    dswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelelaenrei
    lkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlt
    eavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplvklwyql
    ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
    glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1tB (B:)
    pispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpv
    faikkkdstkwrklvdfrelnkrtqdfwevqlgiphpagikkkksvtvldvgdayfsvpl
    dedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdivi
    yqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwt
    vqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeae
    lelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrga
    htndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntp
    plvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1tB (B:)
    pietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfai
    kkkdstkwrklvdfrelnkrtqdfwgiphpagikkkksvtvldvgdayfsvpldedfrky
    taftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddl
    yvgsdleigqhrtkieelrqhllrwgltelhpdkwtvqpivlpekdswtvndiqklvgkl
    nwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskd
    liaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtndvkqlteavqkittesiviwg
    ktpkfklpiqketwetwwteywqatwipewefvntpplvklwyqlekepivgaetf