PDB entry 1s1s

View 1s1s on RCSB PDB site
Description: Crystal Structure of ZipA in complex with indoloquinolizin 10b
Class: cell cycle
Keywords: cell cycle
Deposited on 2004-01-07, released 2005-01-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.226
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: ZIPA, B2412
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77173 (Start-143)
      • conflict (96)
    Domains in SCOPe 2.03: d1s1sa_
  • Chain 'B':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: ZIPA, B2412
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77173
      • conflict (96)
    Domains in SCOPe 2.03: d1s1sb_
  • Heterogens: WAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1sA (A:)
    mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
    lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
    rrmmtpqklreyqdiirevkdana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1sA (A:)
    rkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmv
    kpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmt
    pqklreyqdiirevkdana
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1sB (B:)
    mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
    lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
    rrmmtpqklreyqdiirevkdana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1sB (B:)
    keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
    pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
    qklreyqdiirevkdan