PDB entry 1s1n

View 1s1n on RCSB PDB site
Description: SH3 domain of human nephrocystin
Class: cell adhesion
Keywords: beta barrel, cell adhesion
Deposited on 2004-01-07, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nephrocystin 1
    Species: Homo sapiens [TaxId:9606]
    Gene: NPHP1, NPH1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1s1na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1s1nA (A:)
gseshkwstgeeyiavgdftaqqvgdltfkkgeillviekkpdgwwiakdakgneglvpr
tylepyse

    Sequence, based on observed residues (ATOM records): (download) 
    >1s1nA (A:)
tgeeyiavgdftaqqvgdltfkkgeillviekkpdgwwiakdakgneglvprtylepyse