PDB entry 1s1m

View 1s1m on RCSB PDB site
Description: Crystal Structure of E. Coli CTP Synthetase
Class: Ligase
Keywords: CTP synthetase, UTP:ammonia ligase (ADP-forming), Cytidine 5'-triphosphate synthase, ammonia lyase, class-II glutamine amidotransferase, ammonia tunnel, Ligase
Deposited on 2004-01-06, released 2004-06-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.214
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CTP synthase
    Species: Escherichia coli [TaxId:562]
    Gene: PYRG, B2780, C3345, Z4095, ECS3640, SF2795, S2989
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s1ma1, d1s1ma2
  • Chain 'B':
    Compound: CTP synthase
    Species: Escherichia coli [TaxId:562]
    Gene: PYRG, B2780, C3345, Z4095, ECS3640, SF2795, S2989
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s1mb1, d1s1mb2
  • Heterogens: SO4, MG, IOD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1mA (A:)
    mttnyifvtggvvsslgkgiaaaslaailearglnvtimkldpyinvdpgtmspiqhgev
    fvtedgaetdldlghyerfirtkmsrrnnfttgriysdvlrkerrgdylgatvqviphit
    naikervleggeghdvvlveiggtvgdieslpfleairqmaveigrehtlfmhltlvpym
    aasgevktkptqhsvkellsigiqpdilicrsdravpanerakialfcnvpekavislkd
    vdsiykipgllksqglddyickrfslncpeanlseweqvifeeanpvsevtigmvgkyie
    lpdayksviealkhgglknrvsvniklidsqdvetrgveilkgldailvpggfgyrgveg
    mittarfarennipylgiclgmqvalidyarhvanmenanstefvpdckypvvalitewr
    dengnvevrseksdlggtmrlgaqqcqlvddslvrqlynaptiverhrhryevnnmllkq
    iedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvkaasefq
    krqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1mA (A:)
    mttnyifvtggvvsslgkgiaaaslaailearglnvtimkldpyinvdpgtmspiqhgev
    fvtedgaetdldlghyerfirtkmsrrnnfttgriysdvlrkerrgdylgatvqviphit
    naikervleggeghdvvlveiggtvgdieslpfleairqmaveigrehtlfmhltlvpym
    aasgevktkptqhsvkellsigiqpdilicrsdravpanerakialfcnvpekavislkd
    vdsiykipgllksqglddyickrfslncpeanlseweqvifeeanpvsevtigmvgkyie
    lpdayksviealkhgglknrvsvniklidsqdvetrgveilkgldailvpggfgyrgveg
    mittarfarennipylgiclgmqvalidyarhvanmenanstefvpdckypvvalitewr
    dengnvetmrlgaqqcqlvddslvrqlynaptiverhrhryevnnmllkqiedaglrvag
    rsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvkaasefqkrqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1mB (B:)
    mttnyifvtggvvsslgkgiaaaslaailearglnvtimkldpyinvdpgtmspiqhgev
    fvtedgaetdldlghyerfirtkmsrrnnfttgriysdvlrkerrgdylgatvqviphit
    naikervleggeghdvvlveiggtvgdieslpfleairqmaveigrehtlfmhltlvpym
    aasgevktkptqhsvkellsigiqpdilicrsdravpanerakialfcnvpekavislkd
    vdsiykipgllksqglddyickrfslncpeanlseweqvifeeanpvsevtigmvgkyie
    lpdayksviealkhgglknrvsvniklidsqdvetrgveilkgldailvpggfgyrgveg
    mittarfarennipylgiclgmqvalidyarhvanmenanstefvpdckypvvalitewr
    dengnvevrseksdlggtmrlgaqqcqlvddslvrqlynaptiverhrhryevnnmllkq
    iedaglrvagrsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvkaasefq
    krqak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1mB (B:)
    mttnyifvtggvvsslgkgiaaaslaailearglnvtimkldpyinvdpgtmspiqhgev
    fvtedgaetdldlghyerfirtkmsrrnnfttgriysdvlrkerrgdylgatvqviphit
    naikervleggeghdvvlveiggtvgdieslpfleairqmaveigrehtlfmhltlvpym
    aasgevktkptqhsvkellsigiqpdilicrsdravpanerakialfcnvpekavislkd
    vdsiykipgllksqglddyickrfslncpeanlseweqvifeeanpvsevtigmvgkyie
    lpdayksviealkhgglknrvsvniklidsqdvetrgveilkgldailvpggfgyrgveg
    mittarfarennipylgiclgmqvalidyarhvanmenanstefvpdckypvvalitewr
    dengnvevtmrlgaqqcqlvddslvrqlynaptiverhrhryevnnmllkqiedaglrva
    grsgddqlveiievpnhpwfvacqfhpeftstprdghplfagfvkaasefqkrqak