PDB entry 1s1j

View 1s1j on RCSB PDB site
Description: Crystal Structure of ZipA in complex with indoloquinolizin inhibitor 1
Class: cell cycle
Keywords: cell cycle
Deposited on 2004-01-06, released 2004-05-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.192
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: ZIPA, B2412
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77173
      • conflict (96)
    Domains in SCOPe 2.03: d1s1ja_
  • Chain 'B':
    Compound: cell division protein zipa
    Species: Escherichia coli [TaxId:562]
    Gene: ZIPA, B2412
    Database cross-references and differences (RAF-indexed):
    • Uniprot P77173 (Start-143)
      • conflict (96)
    Domains in SCOPe 2.03: d1s1jb_
  • Heterogens: IQZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1jA (A:)
    mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
    lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
    rrmmtpqklreyqdiirevkdana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1jA (A:)
    keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
    pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
    qklreyqdiirevkda
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1jB (B:)
    mdkpkrkeaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfs
    lanmvkpgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddq
    rrmmtpqklreyqdiirevkdana
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1jB (B:)
    keaviimnvaahhgselngelllnsiqqagfifgdmniyhrhlspdgsgpalfslanmvk
    pgtfdpemkdfttpgvtifmqvpsygdelqlfklmlqsaqhiadevggvvlddqrrmmtp
    qklreyqdiirevkdana