PDB entry 1s1i

View 1s1i on RCSB PDB site
Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1I, Contains 60S subunit. The 40S Ribosomal Subunit Is In File 1S1H.
Deposited on 2004-01-06, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Domains in SCOP 1.71: d1s1i0_
  • Chain '3':
    Domains in SCOP 1.71: d1s1i3_
  • Chain '4':
    Domains in SCOP 1.71: d1s1i4_
  • Chain '9':
    Domains in SCOP 1.71: d1s1i9_
  • Chain 'A':
    Domains in SCOP 1.71: d1s1ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1s1ib_
  • Chain 'C':
    Domains in SCOP 1.71: d1s1ic_
  • Chain 'D':
    Domains in SCOP 1.71: d1s1id_
  • Chain 'E':
    Domains in SCOP 1.71: d1s1ie_
  • Chain 'F':
    Domains in SCOP 1.71: d1s1if_
  • Chain 'G':
    Domains in SCOP 1.71: d1s1ig_
  • Chain 'H':
    Domains in SCOP 1.71: d1s1ih_
  • Chain 'I':
    Domains in SCOP 1.71: d1s1ii_
  • Chain 'J':
    Domains in SCOP 1.71: d1s1ij_
  • Chain 'K':
    Domains in SCOP 1.71: d1s1ik_
  • Chain 'L':
    Domains in SCOP 1.71: d1s1il_
  • Chain 'M':
    Domains in SCOP 1.71: d1s1im_
  • Chain 'N':
    Domains in SCOP 1.71: d1s1in_
  • Chain 'O':
    Domains in SCOP 1.71: d1s1io_
  • Chain 'P':
    Domains in SCOP 1.71: d1s1ip_
  • Chain 'Q':
    Domains in SCOP 1.71: d1s1iq_
  • Chain 'R':
    Domains in SCOP 1.71: d1s1ir_
  • Chain 'S':
    Domains in SCOP 1.71: d1s1is_
  • Chain 'T':
    Domains in SCOP 1.71: d1s1it_
  • Chain 'U':
    Domains in SCOP 1.71: d1s1iu_
  • Chain 'V':
    Domains in SCOP 1.71: d1s1iv_
  • Chain 'W':
    Domains in SCOP 1.71: d1s1iw_
  • Chain 'X':
    Domains in SCOP 1.71: d1s1ix_
  • Chain 'Y':
    Domains in SCOP 1.71: d1s1iy_
  • Chain 'Z':
    Domains in SCOP 1.71: d1s1iz_

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >1s1i0 (0:)
    maslphpkivkkhtkkfkrhhsdryhrvaenwrkqkgidsvvrrrfrgnisqpkigygsn
    kktkflspsghktflvanvkdletltmhtktyaaeiahnisaknrvvilarakalgikvt
    npkgrlalea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1i0 (0:)
    tkkfkrhhsdryhrvaenwrkqkgidsvvrrrfrgnisqpkigygsnkktkflspsghkt
    flvanvkdletltmhtktyaaeiahnisaknrvvilarakalgikvtnp
    

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >1s1i9 (9:)
    akrtkkvgitgkygvrygsslrrqvkkleiqqharydcsfcgkktvkrgaagiwtcscck
    ktvaggaytvstaaaatvrstirrlremvea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1i9 (9:)
    itgkygvrygsslrrqvkkleiqqharydcsfcgkktvkrgaagiwtcscckktvaggay
    tvstaaaatvrst
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1iA (A:)
    mskitssqvrehvkellkysnetkkrnfletvelqvglknydpqrdkrfsgslklpncpr
    pnmsicifgdafdvdrakscgvdamsvddlkklnknkklikklskkynafiasevlikqv
    prllgpqlskagkfptpvshnddlygkvtdvrstikfqlkkvlclavavgnvemeedvlv
    nqilmsvnffvsllkknwqnvgslvvkssmgpafrly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iA (A:)
    itssqvrehvkellkysnetkkrnfletvelqvglknydpqrdkrfsgslklpncprpnm
    sicifgdafdvdrakscgvdamsvddlkklnknkklikklskkynafiasevlikqvprl
    lgpqlskagkfptpvshnddlygkvtdvrstikfqlkkvlclavavgnvemeedvlvnqi
    lmsvnffvsllkknwqnvgslvvkssmgpafrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1iB (B:)
    grvirnqrkgagsiftshtrlrqgaaklrtldyaerhgyirgivkqivhdsgrgaplakv
    vfrdpykyrlreeifianegvhtgqfiyagkkaslnvgnvlplgsvpegtivsnveekpg
    drgalarasgnyviiighnpdenktrvrlpsgakkvissdargvigviagggrvdkpllk
    agrafhkyrlkrnswpktrgvamnpvdhphgggnhqhigkastisrgavsgqkagliaar
    rtgllrgsqktqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iB (B:)
    grvirnqrkgagsiftshtrlrqgaaklrtldyaerhgyirgivkqivhdsgrgaplakv
    vfrdpykyrlreeifianegvhtgqfiyagkkaslnvgnvlplgsvpegtivsnveekpg
    drgalarasgnyviiighnpdenktrvrlpsgakkvissdargvigviagggrvdkpllk
    agrafhkyrlkrnswpktrgvamnpvdhphgggnhqhigkastisrgavsgqkagliaar
    rtgl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s1iC (C:)
    shrkyeaprhghlgflprkraasirarvkafpkddrskpvaltsflgykagmttivrdld
    rpgskfhkrevveavtvvdtppvvvvgvvgyvetprglrslttvwaehlsdevkrrfykn
    wykskkkaftkysakyaqdgagierelarikkyasvvrvlvhtqirktplaqkkahlaei
    qlnggsisekvdwarehfektvavdsvfeqnemidaiavtkghgfegvthrwgtkklprk
    thrglrkvacigawhpahvmwsvaragqrgyhsrtsinhkiyrvgkgddeangatsfdrt
    kktitpmggfvhygeikndfimvkgcipgnrkrivtlrkslytntsrkaleevslkwidt
    askfgkgrfqtpaekhafmgtlkkdl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iC (C:)
    aprhghlgflprkraasirarvkafpkddrskpvaltsflgykagmttivrdldrpgskf
    hkrevveavtvvdtppvvvvgvvgyvetprglrslttvwaehlsdevkrrfyknwykskk
    kaftkysakyaqdgagierelarikkyasvvrvlvhtqirktplaqkkahlaeiqlnggs
    isekvdwarehfektvavdsvfeqnemidaiavtkghgfegvthrwgtkklprkthrglr
    kvacigawhpahvmwsvaragqrgyhsrtsinhkiyrvgkgddeangatsfdrtkktitp
    mggfvhygeikndfimvkgcipgnrkrivtlrkslytntsrkaleevslkwidtaskfg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s1iD (D:)
    srpqvtvhsltgeatanalplpavfsapirpdivhtvftsvnknkrqayavsekaghqts
    aeswgtgravariprvggggtgrsgqgafgnmcrggrmfaptktwrkwnvkvnhnekrya
    tasaiaatavaslvlarghrvekipeiplvvstdlesiqktkeavaalkavgahsdllkv
    lkskklragkgkyrnrrwtqrrgplvvyaedngivkalrnvpgvetanvaslnllqlapg
    ahlgrfviwteaaftkldqvwgsetvasskvgytlpshiistsdvtriinsseiqsairp
    agqatqkrthvlkknplknkqvllrlnpyakvfaaeklgskkaektgtkpaavfaetlkh
    d
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iD (D:)
    qvtvhsltgeatanalplpavfsapirpdivhtvftsvnknkrqayavsekaghqtsaes
    wgtgravariprvggggtgrsgqgafgnmcrggrmfaptktwrkwnvkvnhnekryatas
    aiaatavaslvlarghrvekipeiplvvstdlesiqktkeavaalkavgahsdllkvlks
    kklragkgkyrnrrwtqrrgplvvyaedngivkalrnvpgvetanvaslnllqlapgahl
    grfviwteaaftkldq
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1iE (E:)
    ayssrfqtpfrrrregktdyyqrkrlvtqhkakyntpkyrlvvrftnkdiicqiisstit
    gdvvlaaayshelprygithgltnwaaayatglliarrtlqrlgldetykgveevegeye
    lteavedgprpfkvfldiglqrtttgarvfgalkgasdgglyvphsenrfpgwdfeteei
    dpellrsyifgghvsqymeeladddeerfselfkgyladdid
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1s1iF (F:)
    lvfvvrikginkippkprkvlqllrltrinsgtfvkvtkatlellkliepyvaygypsys
    tirqlvykrgfgkinkqrvplsdnaiieanlgkygilsiddliheiitvgphfkqannfl
    wpfklsnpsggwgvprkfkhfiqggsfgnreefinklvksmn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iF (F:)
    lvfvvrikginkippkprkvlqllrltrinsgtfvkvtkatlellkliepyvaygypsys
    tirqlvykrgfgkinkqrvplsdnaiieanlgkygilsiddliheiitvgphfkqannfl
    wpfklsnpsggwgvprkfkhfiqggsfgnreefinklvksm
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1iG (G:)
    aaekkerltkeaaavaegkskqdaspkpyavkyglnhvvalienkkaklvliandvdpie
    lvvflpalckkmgvpyaivkgkarlgtlvnqktsavaaltevraedeaalaklvstida
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s1iH (H:)
    mkyiqteqqievpegvtvsiksrivkvvgprgtltknlkhidvtftkvnnqlikvavhng
    grkhvaalrtvkslvdnmitgvtkgykykmryvyahfpinvnivekdgakfievrnflgd
    kkirnvpvrdgvtiefstnvkdeivlsgnsvedvsqnaadlqqicrvrnkdirkfldgiy
    vshkgfitedl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iH (H:)
    eqqievpegvtvsiksrivkvvgprgtltknlkhidvtftkvnnqlikvavhnggrkhva
    alrtvkslvdnmitgvtkgykykmryvyahfpinvnivekdgakfievrnflgdkkirnv
    pvrdgvtiefstnvkdeivlsgnsvedvsqnaadlqqicrvrnkdirkfldgiyvshk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s1iI (I:)
    marrparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleql
    ssealeaaricankymttvsgrdafhlrvrvhpfhvlrinkmlscagadrlqqgmrgawg
    kphglaarvdigqiifsvrtkdsnkdvvveglrrarykfpgqqkiils
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iI (I:)
    rparcyryqknkpypksrynravpdskiriydlgkkkatvdefplcvhlvsneleqlsse
    aleaaricankymttvsgrdafhlrvrvhpfhvlrinkmlscagadrlqqgmrgawgkph
    glaarvdigqiifsvrtkdsnkdvvveglrrarykfpgqqkiils
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s1iJ (J:)
    sakaqnpmrdlkieklvlnisvgesgdrltraskvleqlsgqtpvqskarytvrtfgirr
    nekiavhvtvrgpkaeeilerglkvkeyqlrdrnfsatgnfgfgidehidlgikydpsig
    ifgmdfyvvmnrpgarvtrrkrckgtvgnshkttkedtvswfkqkydadvldk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iJ (J:)
    npmrdlkieklvlnisvgesgdrltraskvleqlsgqtpvqskarytvrtfgirrnekia
    vhvtvrgpkaeeilerglkvkeyqlrdrnfsatgnfgfgidehidlgikydpsigifgmd
    fyvvmnrpgarvtrrkrckgtvgnshkttkedtvswfkqkydadv
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1iK (K:)
    lylravggevgasaalapkigplglspkkvgediakatkefkgikvtvqlkiqnrqaaas
    vvpsasslvitalkepprdrkkdknvkhsgniqldeiieiarqmrdksfgrtlasvtkei
    lgtaqsvgcrv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1s1iL (L:)
    gaykyleelqrkkqsdvlrflqrvrvweyrqknvihraarptrpdkarrlgykakqgfvi
    yrvrvrrgnrkrpvpkgatygkptnqgvnelkyqrslrataeervgrraanlrvlnsywv
    nqdstykyfevilvdpqhkairrdarynwicdpvhkhreargltatgkksrginkghkfn
    ntkagrrktwkrqntlslwryrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iL (L:)
    aykyleelqrkkqsdvlrflqrvrvweyrqknvihraarptrpdkarrlgykakqgfviy
    rvrvrrgnrkrpvpkgatygkptnqgvnelkyqrslrataeervgrraanlrvlnsywvn
    qdstykyfevilvdpqhkairrdarynwicdpvhkhreargltatgkksrginkghkfnn
    tkagrrktwkrqnt
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1iM (M:)
    svepvvvidgkghlvgrlasvvakqllngqkivvvraeelnisgeffrnklkyhdflrka
    tafnktrgpfhfrapsrifykalrgmvshktargkaalerlkvfegipppydkkkrvvvp
    qalrvlrlkpgrkyttlgklstsvgw
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1s1iN (N:)
    arygatstnpaksasargsylrvsfkntretaqaingweltkaqkyleqvldhqraipfr
    rfnssigrtaqgkefgvtkarwpaksvkfvqgllqnaaanaeakgldatklyvshiqvnq
    apkqrrrtyrahgrinkyesspshielvvtekeeavakaaekkvvrltsrqrgriaaqkr
    iaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iN (N:)
    atstnpaksasargsylrvsfkntretaqaingweltkaqkyleqvldhqraipfrrfns
    sigrtaqgkefgvtkarwpaksvkfvqgllqnaaanaeakgldatklyvshiqvnqapkq
    rrrtyrahgrinkyesspshielvvte
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1iO (O:)
    dnvylkllvklytflarrtdapfnkvvlkalflskinrppvsvsriaralkqegaanktv
    vvvgtvtddarifefpkttvaalrftagarakivkaggecitldqlavrapkgqntlilr
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1s1iP (P:)
    anlrtqkrlaasvvgvgkrkvwldpnetseiaqansrnairklvkngtivkkavtvhsks
    rtrahaqskregrhsgygkrkgtrearlpsqvvwirrlrvlrrllakyrdagkidkhlyh
    vlykeskgnafkhkralvehii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iP (P:)
    nlrtqkrlaasvvgvgkrkvwldpnetseiaqansrnairklvkngtivkkavtvhsksr
    trahaqskregrhsgygkrkgtrearlpsqvvwirrlrvlrrllakyrdagkidkhlyhv
    lykeskgnafkhkralvehii
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1s1iQ (Q:)
    mgkshgyrsrtrymfqrdfrkhgavhlstylkvykvgdivdikangsiqkgmphkfyqgk
    tgvvynvtkssvgviinkmvgnrylekrlnlrvehikhsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iQ (Q:)
    shgyrsrtrymfqrdfrkhgavhlstylkvykvgdivdikangsiqkgmphkfyqgktgv
    vynvtkssvgviinkmvgnrylekrlnlrvehikhsk
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1s1iR (R:)
    msgngaqgtkfrislglpvgaimncadnsgarnlyiiavkgsgsrlnrlpaaslgdmvma
    tvkkgkpelrkkvmpaivvrqakswrrrdgvflyfednagvianpkgemkgsaitgpvgk
    ecadlwprvasnsgvvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iR (R:)
    qgtkfrislglpvgaimncadnsgarnlyiiavkgsgsrlnrlpaaslgdmvmatvkkgk
    pelrkkvmpaivvrqakswrrrdgvflyfednagvianpkgemkgsaitgpvgkecadlw
    prvasnsgvvv
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1s1iS (S:)
    mkveidsfsgakiypgrgtlfvrgdskifrfqnsksaslfkqrknprriawtvlfr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iS (S:)
    eidsfsgakiypgrgtlfvrgdskifrfqnsksaslfkqrknprriawtvlfr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1s1iT (T:)
    ykvieqpitsetamkkvedgnilvfqvsmkankyqikkavkelyevdvlkvntlvrpngt
    kkayvrltadydaldianrigyi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iT (T:)
    ykvieqpitsetamkkvedgnilvfqvsmkankyqikkavkelyevdvlkvntlvrpngt
    kkayvrltadydaldia
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1s1iU (U:)
    akqsldvssdrrkarkayftapssqrrvllsaplskelraqygikalpirrddevlvvrg
    skkgqegkissvyrlkfavqvdkvtkekvngasvpinlhpsklvitklhldkdrkaliqr
    kggkle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iU (U:)
    ssdrrkarkayftapssqrrvllsaplskelraqygikalpirrddevlvvrgskkgqeg
    kissvyrlkfavqvdkvtkekvngasvpinlhpsklvitklhldkdrkaliqrkg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1s1iV (V:)
    psrftktrkhrghvsagkgrigkhrkhpggrgmaggehhhrinmdkyhpgyfgkvgmryf
    hkqqahfwkpvlnldklwtlipedkrdqylksasketapvidtlaagygkilgkgripnv
    pvivkarfvsklaeekiraaggvvelia
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iV (V:)
    tktrkhrghvsagkgrigkhrkhpggrgmaggehhhrinmdkyhpgyfgkvgmryfhkqq
    ahfwkpvlnldklwtlipedkrdqylksasketapvidtlaagygkilgkgripnvpviv
    karfvsklaeekiraaggvveli
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >1s1iW (W:)
    aglkdvvtreytinlhkrlhgvsfkkrapravkeikkfaklhmgtddvrlapelnqaiwk
    rgvkgveyrlrlrisrkrneeedaknplfsyvepvlvasakglqtvvveeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iW (W:)
    dvvtreytinlhkrlhgvsfkkrapravkeikkfaklhmgtddvrlapelnqaiwkrgvk
    gveyrlrlrisrkrneee
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1s1iX (X:)
    magvkayelrtkskeqlasqlvdlkkelaelkvqklsrpslpkiktvrksiacvltvine
    qqreavrqlykgkkyqpkdlrakktralrraltkfeasqvtekqrkkqiafpqrkyaika
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iX (X:)
    agvkayelrtkskeqlasqlvdlkkelaelkvqklsrpslpkiktvrksiacvltvine
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1s1iY (Y:)
    gkgtpsfgkrhnkshtlcnrcgrrsfhvqkktcsscgypaaktrsynwgakakrrhttgt
    grmrylkhvsrrfkngfqtgsaskasa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iY (Y:)
    gkgtpsfgkrhnkshtlcnrcgrrsfhvqkktcsscgypaaktrsynwgaka
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >1s1iZ (Z:)
    vnvpktrktyckgktcrkhtqhkvtqykagkaslfaqgkrrydrkqsgfggqtkpvfhkk
    akttkkvvlrlecvkcktraqltlkrckhfelggekkqkgqalqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1iZ (Z:)
    vnvpktrktyckgktcrkhtqhkvtqykagkaslfaqgkrrydrkqsgfggqtkpvfhkk
    akttkkvvlrlecvkcktraqltlkrckhfe