PDB entry 1s1h

View 1s1h on RCSB PDB site
Description: Structure of the ribosomal 80S-eEF2-sordarin complex from yeast obtained by docking atomic models for RNA and protein components into a 11.7 A cryo-EM map. This file, 1S1H, Contains 40S subunit. The 60S Ribosomal Subunit Is In File 1S1I.
Deposited on 2004-01-06, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: EM
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s1ha_
  • Chain 'B':
    Domains in SCOP 1.71: d1s1hb_
  • Chain 'C':
    Domains in SCOP 1.71: d1s1hc_
  • Chain 'D':
    Domains in SCOP 1.71: d1s1hd_
  • Chain 'E':
    Domains in SCOP 1.71: d1s1he_
  • Chain 'G':
    Domains in SCOP 1.71: d1s1hg_
  • Chain 'H':
    Domains in SCOP 1.71: d1s1hh_
  • Chain 'I':
    Domains in SCOP 1.71: d1s1hi_
  • Chain 'J':
    Domains in SCOP 1.71: d1s1hj_
  • Chain 'K':
    Domains in SCOP 1.71: d1s1hk_
  • Chain 'L':
    Domains in SCOP 1.71: d1s1hl_
  • Chain 'M':
    Domains in SCOP 1.71: d1s1hm_
  • Chain 'N':
    Domains in SCOP 1.71: d1s1hn_
  • Chain 'O':
    Domains in SCOP 1.71: d1s1ho_
  • Chain 'Q':
    Domains in SCOP 1.71: d1s1hq_
  • Chain 'S':
    Domains in SCOP 1.71: d1s1hs_
  • Chain 'T':
    Domains in SCOP 1.71: d1s1ht_

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hB (B:)
    aqlllaanthlgarnvqvhqepyvfnarpdgvhvinvgktweklvlaariiaaipnpedv
    vaissrtfgqravlkfaahtgatpiagrftpgsftnyitrsfkeprlvivtdprsdaqai
    keasyvnipvialtdldspsefvdvaipcnnrgkhsigliwyllarevlrlrgalvdrtq
    pwsim
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s1hC (C:)
    valiskkrklvadgvfyaelnefftrelaeegysgvevrvtptkteviiratrtqdvlge
    ngrrineltllvqkrfkyapgtivlyaervqdrglsavaqaesmkfkllnglairraayg
    vvryvmesgakgcevvvsgklraarakamkfadgflihsgqpvndfidtatrhvlmrqgv
    lgikvkimrdpa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hC (C:)
    skkrklvadgvfyaelnefftrelaeegysgvevrvtptkteviiratrtqdvlgengrr
    ineltllvqkrfkyapgtivlyaervqdrglsavaqaesmkfkllnglairraaygvvry
    vmesgakgcevvvsgklraarakamkfadgflihsgqpvndfidtatrhvlmrqgvlgik
    vkimrdpa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s1hD (D:)
    yessrldaelklagefglknkkeiyrisfqlskirraardlltrdekdpkrlfegnalir
    rlvrvgvlsedkkkldyvlalkvedflerrlqtqvyklglaksvhharvlitqrhiavgk
    qivnipsfmvrldsekhidfaptspfggarpgrvarrnaarkaeasgeaadeadeadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hD (D:)
    yessrldaelklagefglknkkeiyrisfqlskirraardlltrdekdpkrlfegnalir
    rlvrvgvlsedkkkldyvlalkvedflerrlqtqvyklglaksvhharvlitqrhiavgk
    qivnipsfmvrldsekhidfaptspfggarpgrvarrnaarkaeasgeaadeadeade
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hE (E:)
    glqdevmnikpvqkqtragqrtrfkavvvvgdsnghvglgiktakevagairagiiiakl
    svipirrgywgtnlgqphslatkttgkcgsvtvrlipaprgsgivaspavkkllqlagve
    dvytqsngktrtlentlkaafvaigntyg
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hG (G:)
    ryankrfrkaqcpiierltnslmmngrnngkklkavriikhtldiinvltdqnpiqvvvd
    aitntgpredttrvggggaarrqavdvsplrrvnqaialltigareaafrniktiaetla
    eelinaakgsstsyaikkkdelervaksnr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1s1hH (H:)
    trssvladalnainnaektgkrqvlirpsskviikflqvmqkhgyigefeyiddhrsgki
    vvqlngrlnkcgvisprfnvkigdiekwtanllparqfgyvilttsagimdheearrkhv
    sgkilgfvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hH (H:)
    ssvladalnainnaektgkrqvlirpsskviikflqvmqkhgyigefeyiddhrsgkivv
    qlngrlnkcgvisprfnvkigdiekwtanllparqfgyvilttsagimdheearrkhvsg
    kilgfvy
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1s1hI (I:)
    savpsvqtfgkkksatavahvkagkglikvngspitlvepeilrfkvyeplllvgldkfs
    nidirvrvtggghvsqvyairqaiakglvayhqkyvdeqsknelkkaftsydrtlliads
    rrpepkkfggkgarsrfqksyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hI (I:)
    psvqtfgkkksatavahvkagkglikvngspitlvepeilrfkvyeplllvgldkfsnid
    irvrvtggghvsqvyairqaiakglvayhqkyvdeqsknelkkaftsydrtlliadsrrp
    epkkfggkgarsrfqksyr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1s1hJ (J:)
    kiritltstkvkqlenvssnivknaeqhnlvkkgpvrlptkvlkistrktpngegsktwe
    tyemrihkryidleapvqivkritqitiepgvdvevvasn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hJ (J:)
    kiritltstkvkqlenvssnivknaeqhnlvkkgpvrlptkvlkistrktpngegsktwe
    tyemrihkryidleapvqivkritqitiepgvdvevv
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1s1hK (K:)
    snvvqardnsqvfgvariyasfndtfvhvtdlsgketiarvtggmkvkadrdesspyaam
    laaqdvaakcrevgitavhvkiratggtrtktpgpggqaalralarsglrigriedvtpv
    psdstrkkggrrgrrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hK (K:)
    dnsqvfgvariyasfndtfvhvtdlsgketiarvtggmkvkadrdesspyaamlaaqdva
    akcrevgitavhvkiratggtrtktpgpggqaalralarsglrigriedvtpvpsdstrk
    kggrr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hL (L:)
    nykkrllgtafksspfggsshakgivleklgieskqpnsairkcvrvqlikngkkvtafv
    pndgclnfvdendevllagfgrkgkakgdipgvrfkvvkvsgvsllalwkekkekprs
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1s1hM (M:)
    lrllntnvdgnikivyalttikgvgrrysnlvckkadvdlhkrageltqeelerivqimq
    npthykipawflnrqnditdgkdyhtlannvesklrddlerlkkirahrgirhfwglrvr
    gqhtkttgrrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hM (M:)
    lrllntnvdgnikivyalttikgvgrrysnlvckkadvdlhkrageltqeelerivqimq
    npthykipawflnrqnditdgkdyhtlannvesklrddlerlkkirahrgirhfwglrvr
    gqhtkttgrrr
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1s1hN (N:)
    crvcsshtglvrkydlnicrqcfrekandigfhkyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hN (N:)
    crvcsshtglvrkydlnicrqcfrekand
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hO (O:)
    itgnkimrilksnglapeipedlyylikkavsvrkhlernrkdkdakfrliliesrihrl
    aryyr
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hQ (Q:)
    kiltgtvvstkmhrtivirraylhyipkynryekrhknvpvhvspafrvqvgdivtvgqc
    rpisktvrfnvvkvsa
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s1hS (S:)
    rgmtskpagfmkklraaklaapenekpapvrthmrnmiivpemigsvvgiyngkafnqve
    irpemlghylgefsitytpv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1s1hT (T:)
    mvaftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisaakagearftdtr
    kdeqergitikstaislysemsdedvkeikqktdgnsflinlidspghvdfssevtaalr
    vtdgalvvvdtiegvcvqtetvlrqalgerikpvvvinkvdrallelqvskedlyqtfar
    tvesvnvivstyadevlgdvqvypargtvafgsglhgwaftirqfatryakkfgvdkakm
    mdrlwgdsffnpktkkwtnkdtdaegkplerafnmfildpifrlftaimnfkkdeipvll
    ekleivlkgdekdlegkallkvvmrkflpaadallemivlhlpspvtaqayraeqlyegp
    addanciaikncdpkadlmlyvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvp
    gkkddlfikaiqrvvlmmgrfvepiddcpagniiglvgidqfllktgtlttsetahnmkv
    mkfsvspvvqvavevknandlpklveglkrlsksdpcvltymsesgehivagtgelhlei
    clqdlehdhagvplkisppvvayretvesessqtalskspnkhnriylkaepideevsla
    iengiinprddfkararimaddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheik
    dsvvaafqwatkegpifgeemrsvrvnildvtlhadaihrgggqiiptmrratyagflla
    dpkiqepvflveiqcpeqavggiysvlnkkrgqvvseeqrpgtplftvkaylpvnesfgf
    tgelrqatggqafpqmvfdhwstlgsdpldptskageivlaarkrhgmkeevpgwqeyyd
    kl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1hT (T:)
    aftvdqmrslmdkvtnvrnmsviahvdhgkstltdslvqragiisagitikstaislyse
    msdedvkeikqktdgnsflinlidspghvdfssevtaalrvtdgalvvvdtiegvcvqte
    tvlrqalgerikpvvvinkvdrallelqvskedlyqtfartvesvnvivstyadevlgdv
    qvypargtvafgsglhgwaftirqfatryakkfgvdkakmmdrlwgdsffnpktkkwtnk
    dtdaegkplerafnmfildpifrlftaimnfkkdeipvllekleivlkgdekdlegkall
    kvvmrkflpaadallemivlhlpspvtaqayraeqlyegpaddanciaikncdpkadlml
    yvskmvptsdkgrfyafgrvfagtvksgqkvriqgpnyvpgkkddlfikaiqrvvlmmgr
    fvepiddcpagniiglvgidqfllktgtlttsetahnmkvmkfsvspvvqvavevknand
    lpklveglkrlsksdpcvltymsesgehivagtgelhleiclqdlehdhagvplkisppv
    vayretvesessqtalskspnkhnriylkaepideevslaiengiinprddfkararima
    ddygwdvtdarkiwcfgpdgngpnlvidqtkavqylheikdsvvaafqwatkegpifgee
    mrsvrvnildvtlhadaihrgggqiiptmrratyagflladpkiqepvflveiqcpeqav
    ggiysvlnkkrgqvvseeqtplftvkaylpvnesfgftgelrqatggqafpqmvfdhwst
    lgsdpldptskageivlaarkrhgmkeevpgwqeyydkl