PDB entry 1s1g

View 1s1g on RCSB PDB site
Description: Crystal Structure of Kv4.3 T1 Domain
Class: transport protein
Keywords: K+ channels, tetramerization domain, T1 domain, TRANSPORT PROTEIN
Deposited on 2004-01-06, released 2004-03-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.228
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Potassium voltage-gated channel subfamily D member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Kcnd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UK17 (Start-115)
      • cloning artifact (116-117)
    Domains in SCOPe 2.07: d1s1ga1, d1s1ga2
  • Chain 'B':
    Compound: Potassium voltage-gated channel subfamily D member 3
    Species: Homo sapiens [TaxId:9606]
    Gene: Kcnd3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UK17 (Start-115)
      • cloning artifact (116-117)
      • expression tag (118-119)
    Domains in SCOPe 2.07: d1s1gb1, d1s1gb2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1gA (A:)
    mlapadknkrqdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrd
    pevfrcvlnfyrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1gA (A:)
    delivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnfy
    rtgklhypryecisayddelafygilpeiigdccyeeykdrkrenle
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1gB (B:)
    mlapadknkrqdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrd
    pevfrcvlnfyrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenlehh
    hhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1gB (B:)
    qdelivlnvsgrrfqtwrttlerypdtllgstekefffnedtkeyffdrdpevfrcvlnf
    yrtgklhypryecisayddelafygilpeiigdccyeeykdrkrenlehh