PDB entry 1s1f

View 1s1f on RCSB PDB site
Description: crystal structure of streptomyces coelicolor a3(2) cyp158a2 from antibiotic biosynthetic pathways
Deposited on 2004-01-06, released 2005-01-11
The last revision prior to the SCOP 1.71 freeze date was dated 2005-01-11, with a file datestamp of 2005-01-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.202
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1s1fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1fA (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1fA (A:)
    qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
    rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
    ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
    seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
    nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
    iragdavyvsylaanrdpevfpdpdridfernphvsfgfgphycpggmlarlesellvda
    vldrvpglklavapedvpfkkgalirgpealpvtwha