PDB entry 1s1f

View 1s1f on RCSB PDB site
Description: Crystal Structure of Streptomyces Coelicolor A3(2) CYP158A2 from antibiotic biosynthetic pathways
Class: oxidoreductase
Keywords: streptomyces, Cytochrome P450 oxidoreductase, CYP158A2, antibiotic biosynthesis, oxidoreductase
Deposited on 2004-01-06, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative cytochrome P450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • GB NP_625496 (Start-403)
      • expression tag (404-405)
    Domains in SCOPe 2.07: d1s1fa1, d1s1fa2
  • Heterogens: HG, HEM, PIM, MLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1fA (A:)
    mteetisqavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddv
    rlvtndprfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargverv
    rersrgmldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlils
    sshgaevseraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllq
    iggeavtnnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialed
    veikgvriragdavyvsylaanrdpevfpdpdridferspnphvsfgfgphycpggmlar
    lesellvdavldrvpglklavapedvpfkkgalirgpealpvtwha
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1fA (A:)
    qavppvrdwpavdlpgsdfdpvltelmregpvtrislpngegwawlvtrhddvrlvtndp
    rfgreavmdrqvtrlaphfipargavgfldppdhtrlrrsvaaaftargvervrersrgm
    ldelvdamlragppadlteavlspfpiavicelmgvpatdrhsmhtwtqlilssshgaev
    seraknemnayfsdliglrsdsagedvtsllgaavgrdeitlseavglavllqiggeavt
    nnsgqmfhlllsrpelaerlrsepeirpraidellrwiphrnavglsrialedveikgvr
    iragdavyvsylaanrdpevfpdpdridfernphvsfgfgphycpggmlarlesellvda
    vldrvpglklavapedvpfkkgalirgpealpvtwha