PDB entry 1s1e

View 1s1e on RCSB PDB site
Description: Crystal Structure of Kv Channel-interacting protein 1 (KChIP-1)
Class: transport protein
Keywords: KChIP, Kv Channel-interacting protein, Calcium-binding protein, EF-finger, TRANSPORT PROTEIN
Deposited on 2004-01-06, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.224
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Kv channel interacting protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: KCNIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NZI2
      • conflict (71)
      • expression tag (216-217)
    Domains in SCOPe 2.08: d1s1ea1, d1s1ea2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1eA (A:)
    mgavmgtfsslqtkqrrpskdkiedelemtmvchrpegleqleaqtnftkrelqvlyrgf
    knecpsgvvneetfkqiyaqffphgdastyahylfnafdttqtgsvkfedfvtalsillr
    gtvheklrwtfnlydinkdgyinkeemmdivkaiydmmgkytypvlkedtprqhvdvffq
    kmdknkdgivtldeflescqeddnimrslqlfqnvmvehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1eA (A:)
    gleqleaqtnftkrelqvlyrgfknecpsgvvneetfkqiyaqffphgdastyahylfna
    fdttqtgsvkfedfvtalsillrgtvheklrwtfnlydinkdgyinkeemmdivkaiydm
    mgkytypvlkedtprqhvdvffqkmdknkdgivtldeflescqeddnimrslqlfqnvmv
    e