PDB entry 1s1c

View 1s1c on RCSB PDB site
Description: Crystal structure of the complex between the human RhoA and Rho-binding domain of human ROCKI
Class: signaling protein
Keywords: coiled-coil, GTPase, Rho kinase, ROCK, SIGNALING PROTEIN
Deposited on 2004-01-06, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.219
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHA, ARH12, RHOA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s1ca_
  • Chain 'B':
    Compound: transforming protein rhoa
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHA, ARH12, RHOA, RHO12
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s1cb_
  • Chain 'X':
    Compound: Rho-associated, coiled-coil containing protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13464 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1s1cx1, d1s1cx2
  • Chain 'Y':
    Compound: Rho-associated, coiled-coil containing protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13464 (2-End)
      • cloning artifact (0-1)
    Domains in SCOPe 2.08: d1s1cy1, d1s1cy2
  • Heterogens: MG, GNP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s1cA (A:)
    gsmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1cA (A:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s1cB (B:)
    gsmaairkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalw
    dtagqedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnk
    kdlrndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraa
    lqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1cB (B:)
    airkklvivgdgacgktcllivfskdqfpevyvptvfenyvadievdgkqvelalwdtag
    qedydrlrplsypdtdvilmcfsidspdslenipekwtpevkhfcpnvpiilvgnkkdlr
    ndehtrrelakmkqepvkpeegrdmanrigafgymecsaktkdgvrevfematraalqa
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1s1cX (X:)
    gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
    klaeimnrkdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1cX (X:)
    gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
    klaeimnrk
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1s1cY (Y:)
    gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
    klaeimnrkdf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s1cY (Y:)
    gsmltkdieilrreneeltekmkkaeeeyklekeeeisnlkaafeknintertlktqavn
    klaeimnrkd