PDB entry 1s16

View 1s16 on RCSB PDB site
Description: Crystal Structure of E. coli Topoisomerase IV ParE 43kDa subunit complexed with ADPNP
Class: Isomerase
Keywords: two-domain protein complexed with ADPNP, Isomerase
Deposited on 2004-01-05, released 2004-05-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Topoisomerase IV subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: PARE, NFXD, B3030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s16a1, d1s16a2
  • Chain 'B':
    Compound: Topoisomerase IV subunit B
    Species: Escherichia coli [TaxId:562]
    Gene: PARE, NFXD, B3030
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s16b1, d1s16b2
  • Heterogens: MG, SO4, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s16A (A:)
    mtqtynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilh
    adqsleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvn
    alskrvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfs
    vsrlthvlkakavlcpgveitfkdeinnteqrwcyqdglndylaeavnglptlpekpfig
    nfagdteavdwallwlpeggelltesyvnliptmqggthvnglrqglldamrefceyrni
    lprgvklsaediwdrcayvlsvkmqdpqfagqtkerlssrqcaafvsgvvkdafilwlnq
    nvqaaellaemaissaqrrmraakkvvrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s16A (A:)
    tynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadq
    sleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnals
    krvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsr
    lthvlkakavlcpgveitfkdeinnteqrwcyqdglndylaeavnglptlpekpfignfa
    gdteavdwallwlpeggelltesyvnliptmqggthvnglrqglldamrefceyrnilpr
    gvklsaediwdrcayvlsvkmqdpqfagqtkerlssrqcaafvsgvvkdafilwlnqnvq
    aaellaemaissaqrrmraa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s16B (B:)
    mtqtynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilh
    adqsleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvn
    alskrvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfs
    vsrlthvlkakavlcpgveitfkdeinnteqrwcyqdglndylaeavnglptlpekpfig
    nfagdteavdwallwlpeggelltesyvnliptmqggthvnglrqglldamrefceyrni
    lprgvklsaediwdrcayvlsvkmqdpqfagqtkerlssrqcaafvsgvvkdafilwlnq
    nvqaaellaemaissaqrrmraakkvvrkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s16B (B:)
    tynadaievltglepvrrrpgmytdttrpnhlgqevidnsvdealaghakrvdvilhadq
    sleviddgrgmpvdihpeegvpavelilcrlhaggkfsnknyqfsgglhgvgisvvnals
    krvevnvrrdgqvyniafengekvqdlqvvgtcgkrntgtsvhfwpdetffdsprfsvsr
    lthvlkakavlcpgveitfkdeinnteqrwcyqdglndylaeavnglptlpekpfignfa
    gdteavdwallwlpeggelltesyvnliptmqggthvnglrqglldamrefceyrnilpr
    gvklsaediwdrcayvlsvkmqdpqfagqtkerlssrqcaafvsgvvkdafilwlnqnvq
    aaellaemaissaqrrmraa