PDB entry 1s12

View 1s12 on RCSB PDB site
Description: Crystal structure of TM1457
Class: structural genomics, unknown function
Keywords: crystal, structural genomics, hypothetical protein, PSI, Berkeley Structural Genomics Center, BSGC, Protein Structure Initiative, unknown function
Deposited on 2004-01-05, released 2004-12-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.214
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM1457
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s12a_
  • Chain 'B':
    Compound: hypothetical protein TM1457
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s12b_
  • Chain 'C':
    Compound: hypothetical protein TM1457
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s12c_
  • Chain 'D':
    Compound: hypothetical protein TM1457
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s12d_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s12A (A:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevidngs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s12B (B:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevidngs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1s12C (C:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevidngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s12C (C:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevid
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1s12D (D:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevidngs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s12D (D:)
    mikvtvtnsffevtghapdktlcasvslltqhvanflkaekkakikkesgylkvkfeele
    ncevkvlaamvrslkeleqkfpsqirvevid