PDB entry 1s0w

View 1s0w on RCSB PDB site
Description: 1b Lactamse/ b Lactamase Inhibitor
Class: hydrolase
Keywords: PROTEIN-PROTEIN COMPLEX, TEM-1 BETA-LACTAMASE, BETA-LACTAMASE INHIBITOR PROTEIN, BLIP, Israel Structural Proteomics Center, ISPC, Structural Genomics, HYDROLASE
Deposited on 2004-01-05, released 2004-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.212
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s0wa_
  • Chain 'B':
    Compound: Beta-lactamase TEM
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s0wb_
  • Chain 'C':
    Compound: Beta-lactamase inhibitory protein
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35804 (0-164)
      • engineered (141)
    Domains in SCOPe 2.08: d1s0wc_
  • Chain 'D':
    Compound: Beta-lactamase inhibitory protein
    Species: Streptomyces clavuligerus [TaxId:1901]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35804 (0-164)
      • engineered (141)
    Domains in SCOPe 2.08: d1s0wd_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0wA (A:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0wB (B:)
    hpetlvkvkdaedqlgarvgyieldlnsgkilesfrpeerfpmmstfkvllcgavlsrvd
    agqeqlgrrihysqndlveyspvtekhltdgmtvrelcsaaitmsdntaanlllttiggp
    keltaflhnmgdhvtrldrwepelneaipnderdttmpaamattlrklltgelltlasrq
    qlidwmeadkvagpllrsalpagwfiadksgagergsrgiiaalgpdgkpsrivviyttg
    sqatmdernrqiaeigaslikhw
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0wC (C:)
    agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
    aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
    stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0wD (D:)
    agvmtgakftqiqfgmtrqqvldiagaencetggsfgdsihcrghaagdyyayatfgfts
    aaadakvdsksqekllapsaptltlakfnqvtvgmtraqvlatvgqgscttwseyypayp
    stagvtlslscfdvdgysstgayrgsahlwftdgvlqgkrqwdlv