PDB entry 1s0p

View 1s0p on RCSB PDB site
Description: Structure of the N-Terminal Domain of the Adenylyl Cyclase-Associated Protein (CAP) from Dictyostelium discoideum.
Class: membrane protein
Keywords: Alpha helix bundle, MEMBRANE PROTEIN
Deposited on 2004-01-01, released 2004-01-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.18
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s0pa_
  • Chain 'B':
    Compound: Adenylyl cyclase-associated protein
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: CAP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1s0pb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0pA (A:)
    svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
    elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
    fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0pB (B:)
    svkefqnlvdqhitpfvalskklapevgnqveqlvkaidaekalintasqskkpsqetll
    elikplnnfaaevgkirdsnrsskffnnlsaisesigflswvvveptpgphvaemrgsae
    fytnrilkefkgvnqdqvdwvsnyvnflkdlekyikqyhttgltwnpkggdaksat