PDB entry 1s0h

View 1s0h on RCSB PDB site
Description: Structure determination of haemoglobin from Donkey(equus asinus) at 3.0 Angstrom resolution
Class: oxygen storage/transport
Keywords: alpha helix, dimer
Deposited on 2003-12-31, released 2005-02-01
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.186
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Equus asinus
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Equus asinus
    Domains in SCOP 1.73: d1s0hb1
  • Heterogens: HEM

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s0hB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh