PDB entry 1s0b

View 1s0b on RCSB PDB site
Description: Crystal structure of botulinum neurotoxin type B at pH 4.0
Deposited on 2003-12-30, released 2004-03-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-03-16, with a file datestamp of 2004-03-16.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s0bA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvkapgicidvdnedlffiadknsfsddlsknerieyntqsny
    iendfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqyl
    ysqtfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndf
    vieanksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellip
    vvgafllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmyk
    alnyqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvs
    ylmkkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdls
    iytndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkl
    tssanskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsg
    wkisirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingk
    lesntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsys
    eylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyi
    gekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisds
    defyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcisk
    wylkevkrkpynlklgcnwqfipkdegwte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s0bA (A:)
    pvtinnfnyndpidnnniimmeppfargtgryykafkitdriwiiperytfgykpedfnk
    ssgifnrdvceyydpdylntndkkniflqtmiklfnrikskplgekllemiingipylgd
    rrvpleefntniasvtvnklisnpgeverkkgifanliifgpgpvlnenetidigiqnhf
    asregfggimqmkfcpeyvsvfnnvqenkgasifnrrgyfsdpalilmhelihvlhglyg
    ikvddlpivpnekkffmqstdaiqaeelytfggqdpsiitpstdksiydkvlqnfrgivd
    rlnkvlvcisdpnininiyknkfkdkykfvedsegkysidvesfdklykslmfgftetni
    aenykiktrasyfsdslppvkiknlldneiytieegfnisdkdmekeyrgqnkainkqay
    eeiskehlavykiqmcksvgicidvdnedlffiadknsfsddlsknerieyntqsnyien
    dfpinelildtdliskielpsentesltdfnvdvpvyekqpaikkiftdentifqylysq
    tfpldirdisltssfddallfsnkvysffsmdyiktankvveaglfagwvkqivndfvie
    anksntmdkiadislivpyiglalnvgnetakgnfenafeiagasillefipellipvvg
    afllesyidnknkiiktidnaltkrnekwsdmyglivaqwlstvntqfytikegmykaln
    yqaqaleeiikyryniysekeksninidfndinsklneginqaidninnfingcsvsylm
    kkmiplaveklldfdntlkknllnyidenklyligsaeyekskvnkylktimpfdlsiyt
    ndtiliemfnkynseilnniilnlrykdnnlidlsgygakvevydgvelndknqfkltss
    anskirvtqnqniifnsvfldfsvsfwiripkykndgiqnyihneytiincmknnsgwki
    sirgnriiwtlidingktksvffeynirediseyinrwffvtitnnlnnakiyingkles
    ntdikdireviangeiifkldgdidrtqfiwmkyfsifntelsqsnieerykiqsyseyl
    kdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdlyigek
    fiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisdsdef
    yntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfciskwyl
    kevkrkpynlklgcnwqfipkdegwte