PDB entry 1s08

View 1s08 on RCSB PDB site
Description: Crystal Structure of the D147N Mutant of 7,8-Diaminopelargonic Acid Synthase
Class: transferase
Keywords: Aminotransferase, Fold type I, subclass II, homodimer, TRANSFERASE
Deposited on 2003-12-30, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOA, B0774
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-428)
      • see remark 999 (13)
      • engineered (146)
      • modified residue (273)
    Domains in SCOPe 2.08: d1s08a_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOA, B0774
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
      • engineered (146)
      • modified residue (273)
    Domains in SCOPe 2.08: d1s08b_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s08A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgntfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s08A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgntfgamsvcdpenlfapapqsrmgewderdmvgf
    arlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatgfgrt
    gklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngfmhgptfmgnplaca
    aanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetthpvnmaa
    lqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffcq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s08B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgntfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgrtgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s08B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgntfgamsvcdpnlfapapqsrmdgewderdmvgf
    arlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregilliadeiatgfgrt
    gklfacehaeiapdilclgkaltggtmtlsatlttrevaetisncfmhgptfmgnplaca
    aanaslailesgdwqqqvadievqlreqlapardaemvadvrvlgaigvvetthpvnmaa
    lqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnravqdetffc