PDB entry 1s07

View 1s07 on RCSB PDB site
Description: Crystal Structure of the R253A Mutant of 7,8-Diaminopelargonic Acid Synthase
Class: transferase
Keywords: Aminotransferase, Fold type I, subclass II, homodimer, TRANSFERASE
Deposited on 2003-12-30, released 2004-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOA, B0774
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-428)
      • see remark 999 (13)
      • engineered (252)
    Domains in SCOPe 2.08: d1s07a_
  • Chain 'B':
    Compound: Adenosylmethionine-8-amino-7-oxononanoate aminotransferase
    Species: Escherichia coli [TaxId:562]
    Gene: BIOA, B0774
    Database cross-references and differences (RAF-indexed):
    • Uniprot P12995 (0-End)
      • see remark 999 (13)
      • engineered (252)
    Domains in SCOPe 2.08: d1s07b_
  • Heterogens: NA, PLP, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1s07A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgatgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s07B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgatgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s07B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgatgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffc