PDB entry 1s06

View 1s06 on RCSB PDB site
Description: crystal structure of the r253k mutant of 7,8-diaminopelargonic acid synthase
Deposited on 2003-12-30, released 2004-03-23
The last revision prior to the SCOP 1.67 freeze date was dated 2004-03-23, with a file datestamp of 2004-03-23.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.193
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1s06a_
  • Chain 'B':
    Domains in SCOP 1.67: d1s06b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1s06A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s06A (A:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregil
    liadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisngea
    gcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvrv
    lgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnrav
    qdetffcq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1s06B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffcq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1s06B (B:)
    mttddlafdqrhilhpytsmtsplpvypvvsaegcelilsdgrrlvdgmsswwaaihgyn
    hpqlnaamksqidamshvmfggithapaielcrklvamtpqplecvfladsgsvavevam
    kmalqywqakgearqrfltfrngyhgdtfgamsvcdpdnsmhslwkgylpenlfapapqs
    rmdgewderdmvgfarlmaahrheiaaviiepivqgaggmrmyhpewlkrirkicdregi
    lliadeiatgfgktgklfacehaeiapdilclgkaltggtmtlsatlttrevaetisnge
    agcfmhgptfmgnplacaaanaslailesgdwqqqvadievqlreqlapardaemvadvr
    vlgaigvvetthpvnmaalqkffveqgvwirpfgkliylmppyiilpqqlqrltaavnra
    vqdetffc