PDB entry 1s05

View 1s05 on RCSB PDB site
Description: NMR-validated structural model for oxidized R.palustris cytochrome c556
Class: electron transport
Keywords: this is a model obtained by nmr-restrained modeling and minimization., electron transport
Deposited on 2003-12-30, released 2004-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-03-03, with a file datestamp of 2021-02-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cytochrome c-556
  Species: Rhodopseudomonas palustris [TaxId:1076]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00150 (0-128)
  Domains in SCOPe 2.08: d1s05a_
• Heterogens: HEC

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1s05A (A:)
  qqdlvdktqklmkdngrnmmvlgaiakgekpydqaavdaalkqfdetakdlpklfpdsvk
  glkpfdskyssspkiwaerakfdteiadfakavdgakgkikdvdtlkaamqpigkacgnc
  henfrdkeg